PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00006.302
Common NameAMTR_s00006p00267430, LOC18434091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 251aa    MW: 28492.6 Da    PI: 4.5726
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00006.302genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.5e-204295356
                                              --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                  Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                              k++++t+eq++ Le+ Fe+++++  e++ +LAkklgL+ rqV vWFqNrRa++k
  evm_27.model.AmTr_v1.0_scaffold00006.302 42 KKRRLTAEQVHLLERSFESENKLEPERKSQLAKKLGLQPRQVAVWFQNRRARWK 95
                                              56789************************************************9 PP

2HD-ZIP_I/II134.24.6e-4341133193
                               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkra 69 
                                               ekkrrl++eqv+lLE+sFe+e+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++
  evm_27.model.AmTr_v1.0_scaffold00006.302  41 EKKRRLTAEQVHLLERSFESENKLEPERKSQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSS 109
                                               69******************************************************************* PP

                               HD-ZIP_I/II  70 ydalkeenerLekeveeLreelke 93 
                                               yd+l+++ e+L ke+e+L++e+++
  evm_27.model.AmTr_v1.0_scaffold00006.302 110 YDSLRSDYETLVKEKERLKSEVAS 133
                                               *******************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-203599IPR009057Homeodomain-like
PROSITE profilePS5007117.8153797IPR001356Homeobox domain
SMARTSM003892.0E-1940101IPR001356Homeobox domain
PfamPF000469.4E-184295IPR001356Homeobox domain
CDDcd000865.97E-194298No hitNo description
Gene3DG3DSA:1.10.10.604.0E-2243104IPR009057Homeodomain-like
PRINTSPR000312.5E-66877IPR000047Helix-turn-helix motif
PROSITE patternPS0002707295IPR017970Homeobox, conserved site
PRINTSPR000312.5E-67793IPR000047Helix-turn-helix motif
PfamPF021832.1E-1797139IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MASGRLIFNA CGGNMLFMGA NDSLYHGMNL DDEVYDEHLP EKKRRLTAEQ VHLLERSFES  60
ENKLEPERKS QLAKKLGLQP RQVAVWFQNR RARWKTKQLE RDYDLLKSSY DSLRSDYETL  120
VKEKERLKSE VASLVEKLQA KEIGESDIGS SSPPEEMKPI MSFKIEEGLS CGTGGSAVVD  180
DDGAHLIDSG NSCYPPPDYD RCPSLDGTQS EEDEEVADEK RGRHDQDLYF SEVFGIETEH  240
HDQLGWLVWS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18997RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006844229.10.0PREDICTED: homeobox-leucine zipper protein HAT5
SwissprotQ022832e-66HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLW1PDW90.0W1PDW9_AMBTC; Uncharacterized protein
STRINGVIT_14s0066g01440.t012e-84(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.19e-68homeobox 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]